PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10227.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 998aa    MW: 110326 Da    PI: 4.868
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10227.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.9e-193783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
       KHN10227.1 37 KGQWTPEEDEILRKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                     799****************************9.************986 PP

2Myb_DNA-binding65.78.4e-2189135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde+++d+v+++G++ W+tIa++++ gR +kqc++rw+++l
       KHN10227.1  89 KGPWSKEEDEIIIDLVNRYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 135
                      79******************************.*************97 PP

3Myb_DNA-binding54.72.4e-17141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+  a+ ++ gRt++++k++w+
       KHN10227.1 141 KEAWTQEEELALIRAHQIYGNR-WAELAKLLP-GRTDNSIKNHWN 183
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4713283IPR017930Myb domain
SuperFamilySSF466896.75E-163389IPR009057Homeodomain-like
SMARTSM007171.0E-153685IPR001005SANT/Myb domain
PfamPF002492.0E-163783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-2539100IPR009057Homeodomain-like
CDDcd001671.96E-144083No hitNo description
PROSITE profilePS5129432.42684139IPR017930Myb domain
SuperFamilySSF466892.13E-3186182IPR009057Homeodomain-like
SMARTSM007174.3E-1988137IPR001005SANT/Myb domain
PfamPF002497.6E-1989135IPR001005SANT/Myb domain
CDDcd001679.09E-1791135No hitNo description
Gene3DG3DSA:1.10.10.601.8E-27101143IPR009057Homeodomain-like
SMARTSM007172.8E-17140188IPR001005SANT/Myb domain
PROSITE profilePS5129421.387140190IPR017930Myb domain
PfamPF002491.5E-15141184IPR001005SANT/Myb domain
CDDcd001671.88E-13143183No hitNo description
Gene3DG3DSA:1.10.10.602.1E-22144190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 998 aa     Download sequence    Send to blast
MEGDQTILAA SEGVIEGVQK IRSLNGRTTG PTRRSTKGQW TPEEDEILRK AVQRFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEII IDLVNRYGPK KWSTIAQHLP  120
GRIGKQCRER WHNHLNPTIN KEAWTQEEEL ALIRAHQIYG NRWAELAKLL PGRTDNSIKN  180
HWNSSVKKKL DSYLASGLLT QLQNVPLVGN PNQPIASISS RLQQSGDDNG PRGAEGEEVS  240
QSSQESAKAG HFSSAREMRS VVLQTGEEYK PNEKPSQASC SEPYYVSLDE VTASLQDMAG  300
QGICTSQFIE QKYSHKPRNS TNGDCQLDLL DLTHISSMDF GPESSQLQND RVAPSESPDM  360
VNIPFQTSMG LGVATTMGSI SVKLEHILMS DDECCRILIS EAIGDECFSS GDYNKGVNMV  420
NLSGCTSFLC QSLPSVQSVV SSTGDRLTYT VEPNQLVGSE DQQFVSRTQD NIIYANDLSS  480
SPCIHRIDST EMQEPSDVVK DDSKLVPVNS FGCGSDAKQT SYPTDEKPNV PTEQEDTGAL  540
CYEPPRFPSL DIPFLSCDLI QSGGDMQQEF SPLGIRQFMM SSMNMNLTPF RLWDSPSRDD  600
SPDALLKSAA KTFTGTPSIL KKRNRDLLSP LSDKRIDKRL EIEMTSTLIK NFSRLDVMFD  660
DNETPVADLL PASSMQKRDS GTSVEGDKGS CRQDLVKVER AEDKKKSVIL DDKKSEDDSG  720
GNNSQDKVKQ QPLDVDSEIK NDASAAAEIV QQPSEILVEH DMNDLLLYSP DQVNLKSEKV  780
LSLSARTKKN PCSRINSPSV WVKEHERLSV AVTCVQSISS SGSGENSGDH TGNDGGLETC  840
NIFGGTPFRK SIESPSAWKS PWLINTFLSS PRIDTEITIE DFGYFMSPCD RSYDAIGLMK  900
QISEQTAAQY ASAQEILGNE TPKALPKEAS RNDRDGDQEN IDAHDQHGNH SQLASSALVE  960
RRVLDFSECG TPVRGDSSSK SSAMSFSSPS SYLLKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-70371906159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-70371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003522693.10.0PREDICTED: myb-related protein 3R-1 isoform X1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0B2PRN10.0A0A0B2PRN1_GLYSO; Myb-related protein 3R-1
STRINGGLYMA04G08550.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]